PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.A02444.1.p
Common NameEUGRSUZ_A02444
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 385aa    MW: 42957.9 Da    PI: 7.8103
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.A02444.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.83.9e-31216270155
           G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       k+r+rWt++LHe+Fve+v+ LGG+ekAtPk+il+lm+ +gLt+ h+kSHLQkYR+
  Eucgr.A02444.1.p 216 KTRIRWTQDLHEKFVECVNLLGGAEKATPKAILKLMDSDGLTIFHIKSHLQKYRI 270
                       68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.886213273IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-27214271IPR009057Homeodomain-like
SuperFamilySSF466898.78E-17214270IPR009057Homeodomain-like
TIGRFAMsTIGR015575.4E-23216271IPR006447Myb domain, plants
PfamPF002492.3E-8220269IPR001005SANT/Myb domain
PfamPF143794.0E-19301347IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 385 aa     Download sequence    Send to blast
MIRSNHELTS GDNFERNSHH SRVLSAPPPW NAGISAQPTT RGSCLQSENL GPVKSSSTTM  60
LSCFESPASA FYAAEHCMGF QQRGYDVSSS SDCSQPSKAC DTEFPLYRSS RESFTINLQD  120
QPDPFIESKG QAIAKSPYSN EYDRAAEKCY KFQYTNSQQS KVLAHGQDKL LGDSAASVWR  180
CLSSPSAEKR DQKLEKQPSN FPSANAMSTG SILSNKTRIR WTQDLHEKFV ECVNLLGGAE  240
KATPKAILKL MDSDGLTIFH IKSHLQKYRI AKYMPDSAEG RTARRTSSNE VPQIDIKNSL  300
QIGEALQLQL DVQRRLHEQL EIQRTLQLQI EEQGRQLRMM FDQQQKSSNG PSKSESVNSL  360
EDVHFSATEG LQNTHNTHFP SKIS*
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.A02444.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010058009.10.0PREDICTED: uncharacterized protein LOC104445780 isoform X1
TrEMBLA0A059DIA10.0A0A059DIA1_EUCGR; Uncharacterized protein
STRINGGLYMA09G17404.11e-100(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM54762748
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.17e-70G2-like family protein